PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_1044_iso_7
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family VOZ
Protein Properties Length: 398aa    MW: 44390.9 Da    PI: 5.4877
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_1044_iso_7genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ3921.5e-1201963981200
                                  VOZ   1 pppsaflgpkcalwdctrpaqgsewl...qdycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvq 71 
                                          ppp+aflgpkcalwdc+rpaq  ew+   qdycss+hat+a  eg pg++pvlrp+gi+lkd+llfaalsak+q
  cra_locus_1044_iso_7_len_1416_ver_3 196 PPPAAFLGPKCALWDCPRPAQRLEWCqtsQDYCSSYHATIAPAEGYPGMAPVLRPGGIGLKDNLLFAALSAKAQ 269
                                          89***********************944459******************************************* PP

                                  VOZ  72 gkevgipecegaatakspwnaaelfdlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvm 145
                                          g++vgipecegaat+kspwna+elfdl++legetirewlffdkprrafesgnrkqrslpdy+grgwhesrkqvm
  cra_locus_1044_iso_7_len_1416_ver_3 270 GRDVGIPECEGAATTKSPWNAPELFDLAVLEGETIREWLFFDKPRRAFESGNRKQRSLPDYNGRGWHESRKQVM 343
                                          ************************************************************************** PP

                                  VOZ 146 kefgglkrsyymdpqpsssfewhlyeyeineldalalyrlelklvdekksakgkv 200
                                           ++gglkrsyymdpqp++++ewhlyeyei+++da alyrlelklvd+kks+kgkv
  cra_locus_1044_iso_7_len_1416_ver_3 344 DDYGGLKRSYYMDPQPMKNLEWHLYEYEIKKYDAWALYRLELKLVDGKKSPKGKV 398
                                          *****************************************************97 PP

Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009408Biological Processresponse to heat
GO:0009414Biological Processresponse to water deprivation
GO:0009631Biological Processcold acclimation
GO:0009816Biological Processdefense response to bacterium, incompatible interaction
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048578Biological Processpositive regulation of long-day photoperiodism, flowering
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 398 aa     Download sequence    Send to blast
MGKGSKSGAC KSASHQLFKD RAKNRVDDLQ GMFSDLQSAR KESRTIDVAV LEEQVHQMLR  60
EWKAELNEPS PASSLQGGSL GSFSSDIYRL LQLCEEEDDA TSSLTPPKSE PGIQKVDGGA  120
AFQEEQSFHL LDQCKNTPGA NTMGISNMGV AAPLDYHPFD LHQDFEHQYF TGFEGTGICG  180
EDALSQIPNF AQNFCPPPAA FLGPKCALWD CPRPAQRLEW CQTSQDYCSS YHATIAPAEG  240
YPGMAPVLRP GGIGLKDNLL FAALSAKAQG RDVGIPECEG AATTKSPWNA PELFDLAVLE  300
GETIREWLFF DKPRRAFESG NRKQRSLPDY NGRGWHESRK QVMDDYGGLK RSYYMDPQPM  360
KNLEWHLYEY EIKKYDAWAL YRLELKLVDG KKSPKGKV
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011086028.10.0PREDICTED: transcription factor VOZ1-like isoform X1
RefseqXP_011086027.10.0PREDICTED: transcription factor VOZ1-like isoform X1
SwissprotQ9SGQ00.0VOZ1_ARATH; Transcription factor VOZ1
TrEMBLA0A068TU110.0A0A068TU11_COFCA; Uncharacterized protein
STRINGVIT_10s0003g00500.t010.0(Vitis vinifera)